Lineage for d1cerp2 (1cer P:149-312)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727888Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 727889Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 727890Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 727944Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 728125Species Thermus aquaticus [TaxId:271] [55352] (2 PDB entries)
  8. 728139Domain d1cerp2: 1cer P:149-312 [39903]
    Other proteins in same PDB: d1cera1, d1cerb1, d1cerc1, d1cerd1, d1cero1, d1cerp1, d1cerq1, d1cerr1

Details for d1cerp2

PDB Entry: 1cer (more details), 2.5 Å

PDB Description: determinants of enzyme thermostability observed in the molecular structure of thermus aquaticus d-glyceraldehyde-3-phosphate dehydrogenase at 2.5 angstroms resolution
PDB Compounds: (P:) holo-d-glyceraldehyde-3-phosphate dehydrogenase

SCOP Domain Sequences for d1cerp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cerp2 d.81.1.1 (P:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]}
cttnslapvmkvleeafgvekalmttvhsytndqrlldlphkdlrraraaainiiptttg
aakatalvlpslkgrfdgmalrvptatgsisditallkrevtaeevnaalkaaaegplkg
ilaytedeivlqdivmdphssivdakltkalgnmvkvfawyd

SCOP Domain Coordinates for d1cerp2:

Click to download the PDB-style file with coordinates for d1cerp2.
(The format of our PDB-style files is described here.)

Timeline for d1cerp2: