Lineage for d7jmkc1 (7jmk C:2-130)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845549Family c.2.1.8: CoA-binding domain [51900] (6 proteins)
  6. 2845567Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (6 species)
  7. 2845600Species Pig (Sus scrofa) [TaxId:9823] [51903] (13 PDB entries)
  8. 2845607Domain d7jmkc1: 7jmk C:2-130 [399012]
    Other proteins in same PDB: d7jmka2, d7jmkb1, d7jmkb2, d7jmkc2, d7jmkd1, d7jmkd2
    automated match to d1euda1
    complexed with gdp, mg

Details for d7jmkc1

PDB Entry: 7jmk (more details), 2.5 Å

PDB Description: gtp-specific succinyl-coa synthetase complexed with mg-gdp in space group p32
PDB Compounds: (C:) Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial

SCOPe Domain Sequences for d7jmkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jmkc1 c.2.1.8 (C:2-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]}
sytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpvf
ntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrllr
qgktrligp

SCOPe Domain Coordinates for d7jmkc1:

Click to download the PDB-style file with coordinates for d7jmkc1.
(The format of our PDB-style files is described here.)

Timeline for d7jmkc1: