Lineage for d7jmka1 (7jmk A:2-130)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430117Family c.2.1.8: CoA-binding domain [51900] (6 proteins)
  6. 2430135Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (6 species)
  7. 2430165Species Pig (Sus scrofa) [TaxId:9823] [51903] (13 PDB entries)
  8. 3098946Domain d7jmka1: 7jmk A:2-130 [399008]
    Other proteins in same PDB: d7jmka2, d7jmkb1, d7jmkb2, d7jmkc2, d7jmkd1, d7jmkd2
    automated match to d1euda1
    complexed with gdp, mg

Details for d7jmka1

PDB Entry: 7jmk (more details), 2.5 Å

PDB Description: gtp-specific succinyl-coa synthetase complexed with mg-gdp in space group p32
PDB Compounds: (A:) Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial

SCOPe Domain Sequences for d7jmka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jmka1 c.2.1.8 (A:2-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]}
sytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpvf
ntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrllr
qgktrligp

SCOPe Domain Coordinates for d7jmka1:

Click to download the PDB-style file with coordinates for d7jmka1.
(The format of our PDB-style files is described here.)

Timeline for d7jmka1:

  • d7jmka1 is new in SCOPe 2.07-stable