Lineage for d7jj0c2 (7jj0 C:131-306)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439017Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2439018Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 2439025Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (6 species)
  7. 2439055Species Pig (Sus scrofa) [TaxId:9823] [52214] (13 PDB entries)
  8. 3098927Domain d7jj0c2: 7jj0 C:131-306 [398989]
    Other proteins in same PDB: d7jj0a1, d7jj0b1, d7jj0b2, d7jj0c1, d7jj0d1, d7jj0d2
    automated match to d1euda2
    complexed with gcp, mg

Details for d7jj0c2

PDB Entry: 7jj0 (more details), 2.25 Å

PDB Description: gtp-specific succinyl-coa synthetase complexed with mg-gmppcp
PDB Compounds: (C:) Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial

SCOPe Domain Sequences for d7jj0c2:

Sequence, based on SEQRES records: (download)

>d7jj0c2 c.23.4.1 (C:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp
fngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskpvvsfiaglt
appgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefekrkml

Sequence, based on observed residues (ATOM records): (download)

>d7jj0c2 c.23.4.1 (C:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp
fngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskpvvsfiaglt
appghagaiiggakekitalqsagvvvsmspaqlgttiykefekrkml

SCOPe Domain Coordinates for d7jj0c2:

Click to download the PDB-style file with coordinates for d7jj0c2.
(The format of our PDB-style files is described here.)

Timeline for d7jj0c2:

  • d7jj0c2 is new in SCOPe 2.07-stable