Lineage for d7jfpb2 (7jfp B:246-393)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439017Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2439018Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 2439066Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (3 species)
  7. 2439092Species Pig (Sus scrofa) [TaxId:9823] [52217] (13 PDB entries)
  8. 3098924Domain d7jfpb2: 7jfp B:246-393 [398986]
    Other proteins in same PDB: d7jfpa1, d7jfpa2, d7jfpb1
    automated match to d2nu8e1
    complexed with gdp, gol, mg

Details for d7jfpb2

PDB Entry: 7jfp (more details), 2.55 Å

PDB Description: gtp-specific succinyl-coa synthetase complexed with mg-gdp, phosphohistidine loop pointing towards nucleotide binding site
PDB Compounds: (B:) Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial

SCOPe Domain Sequences for d7jfpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jfpb2 c.23.4.1 (B:246-393) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
epieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggvkesqv
yqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtnvheaq
niltnsglpitsavdledaakkavasvt

SCOPe Domain Coordinates for d7jfpb2:

Click to download the PDB-style file with coordinates for d7jfpb2.
(The format of our PDB-style files is described here.)

Timeline for d7jfpb2:

  • d7jfpb2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d7jfpb1