Lineage for d7jj0d2 (7jj0 D:246-393)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439017Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2439018Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 2439066Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (3 species)
  7. 2439092Species Pig (Sus scrofa) [TaxId:9823] [52217] (13 PDB entries)
  8. 3098916Domain d7jj0d2: 7jj0 D:246-393 [398978]
    Other proteins in same PDB: d7jj0a1, d7jj0a2, d7jj0b1, d7jj0c1, d7jj0c2, d7jj0d1
    automated match to d2nu8e1
    complexed with gcp, mg

Details for d7jj0d2

PDB Entry: 7jj0 (more details), 2.25 Å

PDB Description: gtp-specific succinyl-coa synthetase complexed with mg-gmppcp
PDB Compounds: (D:) Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial

SCOPe Domain Sequences for d7jj0d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jj0d2 c.23.4.1 (D:246-393) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
epieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggvkesqv
yqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtnvheaq
niltnsglpitsavdledaakkavasvt

SCOPe Domain Coordinates for d7jj0d2:

Click to download the PDB-style file with coordinates for d7jj0d2.
(The format of our PDB-style files is described here.)

Timeline for d7jj0d2:

  • d7jj0d2 is new in SCOPe 2.07-stable