SCOP 1.71: Domain d2gd1q2: 2gd1 Q:149-312

Lineage for d2gd1q2 (2gd1 Q:149-312)

Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
N-terminal domain is the classic Rossmann-fold
Family d.81.1.1: GAPDH-like [55348] (4 proteins)
has many additional secondary structures
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species)
Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (10 PDB entries)
Domain d2gd1q2: 2gd1 Q:149-312 [39895]
Other proteins in same PDB: d2gd1o1, d2gd1p1, d2gd1q1, d2gd1r1

Details for d2gd1q2

PDB Entry: 2gd1 (more details), 2.5 Å

PDB Description: coenzyme-induced conformational changes in glyceraldehyde-3-phosphate dehydrogenase from bacillus stearothermophillus

SCOP Domain Sequences for d2gd1q2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gd1q2 d.81.1.1 (Q:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
cttnclapfakvlheqfgivrgmmttvhsytndqrildlphkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

SCOP Domain Coordinates for d2gd1q2:

Click to download the PDB-style file with coordinates for d2gd1q2.
(The format of our PDB-style files is described here.)

Timeline for d2gd1q2: