SCOP 1.63: Domain d2gd1p2: 2gd1 P:149-312

Lineage for d2gd1p2 (2gd1 P:149-312)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (2 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (13 species)

7. Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (6 PDB entries)

8. Domain d2gd1p2: 2gd1 P:149-312 [39894]
   Other proteins in same PDB: d2gd1o1, d2gd1p1, d2gd1q1, d2gd1r1

Details for d2gd1p2

PDB Entry: 2gd1, 2.5 Å

PDB Description: coenzyme-induced conformational changes in glyceraldehyde-3-phosphate dehydrogenase from bacillus stearothermophillus

SCOP Domain Sequences for d2gd1p2:

Sequence; same for both SEQRES and ATOM records:

>d2gd1p2 d.81.1.1 (P:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
cttnclapfakvlheqfgivrgmmttvhsytndqrildlphkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

Timeline for d2gd1p2:

• d2gd1p2 first appeared (with stable ids) in SCOP 1.55
  
• d2gd1p2 appears in SCOP 1.61
  
• d2gd1p2 appears in SCOP 1.65
  
• d2gd1p2 appears in the current release, SCOPe 2.08