SCOP 1.59: Domain d2gd1o2: 2gd1 O:149-312

Lineage for d2gd1o2 (2gd1 O:149-312)

Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
Family d.81.1.1: GAPDH-like [55348] (2 proteins)
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (12 species)
Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (6 PDB entries)
Domain d2gd1o2: 2gd1 O:149-312 [39893]
Other proteins in same PDB: d2gd1o1, d2gd1p1, d2gd1q1, d2gd1r1

Details for d2gd1o2

PDB Entry: 2gd1 (more details), 2.5 Å

PDB Description: coenzyme-induced conformational changes in glyceraldehyde-3-phosphate dehydrogenase from bacillus stearothermophillus

SCOP Domain Sequences for d2gd1o2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gd1o2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
cttnclapfakvlheqfgivrgmmttvhsytndqrildlphkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

SCOP Domain Coordinates for d2gd1o2:

Click to download the PDB-style file with coordinates for d2gd1o2.
(The format of our PDB-style files is described here.)

Timeline for d2gd1o2: