Lineage for d4dbvo2 (4dbv O:149-312)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33775Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 33776Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 33777Family d.81.1.1: GAPDH-like [55348] (2 proteins)
  6. 33783Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (11 species)
  7. 33784Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (6 PDB entries)
  8. 33797Domain d4dbvo2: 4dbv O:149-312 [39889]
    Other proteins in same PDB: d4dbvo1, d4dbvp1, d4dbvq1, d4dbvr1

Details for d4dbvo2

PDB Entry: 4dbv (more details), 2.5 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with leu 33 replaced by thr, thr 34 replaced by gly, asp 36 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nadp+

SCOP Domain Sequences for d4dbvo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dbvo2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
cttnclapfakvlheqfgivrgmmttvhsytndqrildashkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

SCOP Domain Coordinates for d4dbvo2:

Click to download the PDB-style file with coordinates for d4dbvo2.
(The format of our PDB-style files is described here.)

Timeline for d4dbvo2: