Lineage for d1gd1r2 (1gd1 R:149-312)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606541Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 606542Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 606543Family d.81.1.1: GAPDH-like [55348] (4 proteins)
    has many additional secondary structures
  6. 606585Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species)
  7. 606597Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (10 PDB entries)
  8. 606601Domain d1gd1r2: 1gd1 R:149-312 [39880]
    Other proteins in same PDB: d1gd1o1, d1gd1p1, d1gd1q1, d1gd1r1
    complexed with nad, so4

Details for d1gd1r2

PDB Entry: 1gd1 (more details), 1.8 Å

PDB Description: structure of holo-glyceraldehyde-3-phosphate dehydrogenase from bacillus stearothermophilus at 1.8 angstroms resolution

SCOP Domain Sequences for d1gd1r2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd1r2 d.81.1.1 (R:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
cttnclapfakvlheqfgivrgmmttvhsytndqrildlphkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

SCOP Domain Coordinates for d1gd1r2:

Click to download the PDB-style file with coordinates for d1gd1r2.
(The format of our PDB-style files is described here.)

Timeline for d1gd1r2: