SCOP 1.59: Domain d1gd1p2: 1gd1 P:149-312

Lineage for d1gd1p2 (1gd1 P:149-312)

Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
Family d.81.1.1: GAPDH-like [55348] (2 proteins)
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (12 species)
Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (6 PDB entries)
Domain d1gd1p2: 1gd1 P:149-312 [39878]
Other proteins in same PDB: d1gd1o1, d1gd1p1, d1gd1q1, d1gd1r1

Details for d1gd1p2

PDB Entry: 1gd1 (more details), 1.8 Å

PDB Description: structure of holo-glyceraldehyde-3-phosphate dehydrogenase from bacillus stearothermophilus at 1.8 angstroms resolution

SCOP Domain Sequences for d1gd1p2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd1p2 d.81.1.1 (P:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
cttnclapfakvlheqfgivrgmmttvhsytndqrildlphkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

SCOP Domain Coordinates for d1gd1p2:

Click to download the PDB-style file with coordinates for d1gd1p2.
(The format of our PDB-style files is described here.)

Timeline for d1gd1p2: