Lineage for d1dc3b2 (1dc3 B:149-312)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606541Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 606542Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 606543Family d.81.1.1: GAPDH-like [55348] (4 proteins)
    has many additional secondary structures
  6. 606585Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species)
  7. 606638Species Escherichia coli [TaxId:562] [55350] (7 PDB entries)
  8. 606645Domain d1dc3b2: 1dc3 B:149-312 [39874]
    Other proteins in same PDB: d1dc3a1, d1dc3b1

Details for d1dc3b2

PDB Entry: 1dc3 (more details), 2.5 Å

PDB Description: structural analysis of glyceraldehyde 3-phosphate dehydrogenase from escherichia coli: direct evidence for substrate binding and cofactor-induced conformational changes

SCOP Domain Sequences for d1dc3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dc3b2 d.81.1.1 (B:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli}
cttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniipsst
gaakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegemk
gvlgyteddvvstdfngevctsvfdakagialndnfvklvswyd

SCOP Domain Coordinates for d1dc3b2:

Click to download the PDB-style file with coordinates for d1dc3b2.
(The format of our PDB-style files is described here.)

Timeline for d1dc3b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dc3b1