![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.1: GAPDH-like [55348] (4 proteins) has many additional secondary structures |
![]() | Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species) |
![]() | Species Escherichia coli [TaxId:562] [55350] (7 PDB entries) |
![]() | Domain d1gaep2: 1gae P:149-312 [39870] Other proteins in same PDB: d1gaeo1, d1gaep1 complexed with nad; mutant |
PDB Entry: 1gae (more details), 2.17 Å
SCOP Domain Sequences for d1gaep2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gaep2 d.81.1.1 (P:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli} cttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniipsst gaakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegemk gvlgyteddvvstdfngevctsvfdakagialndnfvklvswyd
Timeline for d1gaep2: