SCOPe 2.08: Domain d7cswb_: 7csw B:

Lineage for d7cswb_ (7csw B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (21 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [398682] (3 PDB entries)

8. Domain d7cswb_: 7csw B: [398685]
   automated match to d4mcxa_
   protein/DNA complex; complexed with da, dt

Details for d7cswb_

PDB Entry: 7csw, 1.97 Å

PDB Description: pseudomonas aeruginosa antitoxin higa with pa2440 promoter

PDB Compounds: (B:) HTH cro/C1-type domain-containing protein

SCOPe Domain Sequences for d7cswb_:

Sequence; same for both SEQRES and ATOM records:

>d7cswb_ a.35.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
pihpgeilrdeflmefdispaalaralkvsaptvndivreqrgisadmairlgryfdtsa
qfwmnlqseyslatayaangkqieheieplla

Timeline for d7cswb_:

• d7cswb_ first appeared in SCOPe 2.07