Lineage for d1dc5b2 (1dc5 B:149-312)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2961611Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2961702Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species)
  7. 2961758Species Escherichia coli [TaxId:562] [55350] (12 PDB entries)
    Uniprot P06977
  8. 2961767Domain d1dc5b2: 1dc5 B:149-312 [39868]
    Other proteins in same PDB: d1dc5a1, d1dc5b1

Details for d1dc5b2

PDB Entry: 1dc5 (more details), 2 Å

PDB Description: structural analysis of glyceraldehyde 3-phosphate dehydrogenase from escherichia coli: direct evidence for substrate binding and cofactor-induced conformational changes
PDB Compounds: (B:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1dc5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dc5b2 d.81.1.1 (B:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]}
cttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniipsst
gaakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegemk
gvlgyteddvvstdfngevctsvfdakagialndnfvklvswyd

SCOPe Domain Coordinates for d1dc5b2:

Click to download the PDB-style file with coordinates for d1dc5b2.
(The format of our PDB-style files is described here.)

Timeline for d1dc5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dc5b1