Lineage for d1gadp2 (1gad P:149-312)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727888Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 727889Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 727890Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 727944Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 728006Species Escherichia coli [TaxId:562] [55350] (7 PDB entries)
  8. 728011Domain d1gadp2: 1gad P:149-312 [39866]
    Other proteins in same PDB: d1gado1, d1gadp1
    complexed with nad

Details for d1gadp2

PDB Entry: 1gad (more details), 1.8 Å

PDB Description: comparison of the structures of wild type and a n313t mutant of escherichia coli glyceraldehyde 3-phosphate dehydrogenases: implication for nad binding and cooperativity
PDB Compounds: (P:) d-glyceraldehyde-3-phosphate dehydrogenase

SCOP Domain Sequences for d1gadp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gadp2 d.81.1.1 (P:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]}
cttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniipsst
gaakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegemk
gvlgyteddvvstdfngevctsvfdakagialndnfvklvswyd

SCOP Domain Coordinates for d1gadp2:

Click to download the PDB-style file with coordinates for d1gadp2.
(The format of our PDB-style files is described here.)

Timeline for d1gadp2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gadp1