SCOP 1.55: Domain d1gado2: 1gad O:149-312

Lineage for d1gado2 (1gad O:149-312)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)

5. Family d.81.1.1: GAPDH-like [55348] (2 proteins)

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (11 species)

7. Species Escherichia coli [TaxId:562] [55350] (6 PDB entries)

8. Domain d1gado2: 1gad O:149-312 [39865]
   Other proteins in same PDB: d1gado1, d1gadp1

Details for d1gado2

PDB Entry: 1gad, 1.8 Å

PDB Description: comparison of the structures of wild type and a n313t mutant of escherichia coli glyceraldehyde 3-phosphate dehydrogenases: implication for nad binding and cooperativity

SCOP Domain Sequences for d1gado2:

Sequence; same for both SEQRES and ATOM records:

>d1gado2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli}
cttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniipsst
gaakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegemk
gvlgyteddvvstdfngevctsvfdakagialndnfvklvswyd

Timeline for d1gado2:

• d1gado2 appears in SCOP 1.57
  
• d1gado2 appears in the current release, SCOPe 2.08