Lineage for d7bepl2 (7bep L:107-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751132Domain d7bepl2: 7bep L:107-214 [398566]
    Other proteins in same PDB: d7bepa_, d7bepb1, d7bepc1, d7bepc2, d7bepd_, d7bepe1, d7bepe2, d7bepf1, d7bepi1, d7bepl1
    automated match to d1dn0a2
    complexed with cl, glu, gly, gol, imd, peg, pg4, pge

Details for d7bepl2

PDB Entry: 7bep (more details), 2.61 Å

PDB Description: crystal structure of the receptor binding domain of sars-cov-2 spike glycoprotein in a ternary complex with covox-384 and s309 fabs
PDB Compounds: (L:) S309 light chain

SCOPe Domain Sequences for d7bepl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bepl2 b.1.1.2 (L:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d7bepl2:

Click to download the PDB-style file with coordinates for d7bepl2.
(The format of our PDB-style files is described here.)

Timeline for d7bepl2: