Lineage for d7av1a1 (7av1 A:2-208)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820567Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2820568Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2820655Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2820656Protein automated matches [254706] (5 species)
    not a true protein
  7. 2820660Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries)
  8. 2820662Domain d7av1a1: 7av1 A:2-208 [398395]
    Other proteins in same PDB: d7av1a2, d7av1a3
    automated match to d3b7sa2
    complexed with act, imd, rzk, yb, zn

Details for d7av1a1

PDB Entry: 7av1 (more details), 1.79 Å

PDB Description: lta4 hydrolase in complex with fragment2
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d7av1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7av1a1 b.98.1.0 (A:2-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltiek
vvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeqt
sgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdped
psrkiykfiqkvpipcylialvvga

SCOPe Domain Coordinates for d7av1a1:

Click to download the PDB-style file with coordinates for d7av1a1.
(The format of our PDB-style files is described here.)

Timeline for d7av1a1: