Class b: All beta proteins [48724] (180 folds) |
Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) |
Family b.98.1.0: automated matches [254305] (1 protein) not a true family |
Protein automated matches [254706] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries) |
Domain d7av1a1: 7av1 A:2-208 [398395] Other proteins in same PDB: d7av1a2, d7av1a3 automated match to d3b7sa2 complexed with act, imd, rzk, yb, zn |
PDB Entry: 7av1 (more details), 1.79 Å
SCOPe Domain Sequences for d7av1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7av1a1 b.98.1.0 (A:2-208) automated matches {Human (Homo sapiens) [TaxId: 9606]} vdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltiek vvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeqt sgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdped psrkiykfiqkvpipcylialvvga
Timeline for d7av1a1: