Lineage for d1clic1 (1cli C:2005-2170)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (4 superfamilies) 
Superfamily d.79.4: Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain [55326] (1 family) 
Family d.79.4.1: Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain [55327] (1 protein) Protein Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain [55328] (1 species) Species Escherichia coli [TaxId:562] [55329] (1 PDB entry) 
Domain d1clic1: 1cli C:2005-2170 [39818]
Other proteins in same PDB: d1clia2, d1clib2, d1clic2, d1clid2
Details for d1clic1
PDB Entry: 1cli (more details), 2.5 Å
PDB Description: x-ray crystal structure of aminoimidazole ribonucleotide synthetase (purm), from the e. coli purine biosynthetic pathway, at 2.5 a resolution
SCOP Domain Sequences for d1clic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1clic1 d.79.4.1 (C:2005-2170) Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain {Escherichia coli}
tslsykdagvdidagnalvgrikgvvkktrrpevmgglggfgalcalpqkyrepvlvsgt
dgvgtklrlamdlkrhdtigidlvamcvndlvvqgaeplffldyyatgkldvdtasavis
giaegclqsgcslvggetaempgmyhgedydvagfcvgvvekseii
SCOP Domain Coordinates for d1clic1:
Click to download the PDB-style file with coordinates for d1clic1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1clic1:
View in 3D
