Lineage for d1dt9a2 (1dt9 A:277-422)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2566728Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2566837Family d.79.3.2: ERF1/Dom34 C-terminal domain-like [55323] (3 proteins)
    automatically mapped to Pfam PF03465
  6. 2566838Protein C-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 [55324] (1 species)
    contains a large insertion forming a separate (sub)domain
  7. 2566839Species Human (Homo sapiens) [TaxId:9606] [55325] (1 PDB entry)
  8. 2566840Domain d1dt9a2: 1dt9 A:277-422 [39815]
    Other proteins in same PDB: d1dt9a1, d1dt9a3

Details for d1dt9a2

PDB Entry: 1dt9 (more details), 2.7 Å

PDB Description: the crystal structure of human eukaryotic release factor erf1-mechanism of stop codon recognition and peptidyl-trna hydrolysis
PDB Compounds: (A:) protein (eukaryotic peptide chain release factor subunit 1)

SCOPe Domain Sequences for d1dt9a2:

Sequence, based on SEQRES records: (download)

>d1dt9a2 d.79.3.2 (A:277-422) C-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 {Human (Homo sapiens) [TaxId: 9606]}
nvkfiqekkligryfdeisqdtgkycfgvedtlkalemgaveilivyenldimryvlhcq
gteeekilyltpeqekdkshftdketgqeheliesmpllewfannykkfgatleivtdks
qegsqfvkgfggiggilryrvdfqgm

Sequence, based on observed residues (ATOM records): (download)

>d1dt9a2 d.79.3.2 (A:277-422) C-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 {Human (Homo sapiens) [TaxId: 9606]}
nvkfiqekkligryfdeisqdtgkycfgvedtlkalemgaveilivyenldimryvlily
ltpeqekdkshftesmpllewfannykkfgatleivtdksqegsqfvkgfggiggilryr
vdfqgm

SCOPe Domain Coordinates for d1dt9a2:

Click to download the PDB-style file with coordinates for d1dt9a2.
(The format of our PDB-style files is described here.)

Timeline for d1dt9a2: