Lineage for d1e7kb_ (1e7k B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81402Fold d.79: Bacillus chorismate mutase-like [55297] (4 superfamilies)
  4. 81482Superfamily d.79.3: L30e-like [55315] (2 families) (S)
  5. 81483Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)
  6. 81497Protein Spliceosomal 15.5kd protein [55321] (1 species)
  7. 81498Species Human (Homo sapiens) [TaxId:9606] [55322] (1 PDB entry)
  8. 81500Domain d1e7kb_: 1e7k B: [39814]

Details for d1e7kb_

PDB Entry: 1e7k (more details), 2.9 Å

PDB Description: crystal structure of the spliceosomal 15.5kd protein bound to a u4 snrna fragment

SCOP Domain Sequences for d1e7kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7kb_ d.79.3.1 (B:) Spliceosomal 15.5kd protein {Human (Homo sapiens)}
vnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaadaeplei
ilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqsiqqsier
llv

SCOP Domain Coordinates for d1e7kb_:

Click to download the PDB-style file with coordinates for d1e7kb_.
(The format of our PDB-style files is described here.)

Timeline for d1e7kb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e7ka_