Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.3: L30e-like [55315] (3 families) |
Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins) |
Protein Ribosomal protein L7ae [55319] (1 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (12 PDB entries) |
Domain d1ffke_: 1ffk E: [39812] Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkc_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffkz_ complexed with cd, k, mo3; mutant |
PDB Entry: 1ffk (more details), 2.4 Å
SCOP Domain Sequences for d1ffke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffke_ d.79.3.1 (E:) Ribosomal protein L7ae {Archaeon Haloarcula marismortui} vyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeivm hipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr
Timeline for d1ffke_: