Lineage for d6vjkf_ (6vjk F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2806418Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 2806419Protein automated matches [190537] (10 species)
    not a true protein
  7. 2806497Species Streptomyces avidinii [TaxId:1895] [397827] (1 PDB entry)
  8. 2806503Domain d6vjkf_: 6vjk F: [397882]
    automated match to d2zsca_
    complexed with btn; mutant

Details for d6vjkf_

PDB Entry: 6vjk (more details), 1.6 Å

PDB Description: streptavidin mutant m88 (n49c/a86c)
PDB Compounds: (F:) streptavidin

SCOPe Domain Sequences for d6vjkf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vjkf_ b.61.1.0 (F:) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgcaesryvltgrydsapatdgsgtal
gwtvawknnyrnchsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
kps

SCOPe Domain Coordinates for d6vjkf_:

Click to download the PDB-style file with coordinates for d6vjkf_.
(The format of our PDB-style files is described here.)

Timeline for d6vjkf_: