Class b: All beta proteins [48724] (180 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.0: automated matches [191402] (1 protein) not a true family |
Protein automated matches [190537] (10 species) not a true protein |
Species Streptomyces avidinii [TaxId:1895] [397827] (1 PDB entry) |
Domain d6vjkh_: 6vjk H: [397878] automated match to d2zsca_ complexed with btn; mutant |
PDB Entry: 6vjk (more details), 1.6 Å
SCOPe Domain Sequences for d6vjkh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vjkh_ b.61.1.0 (H:) automated matches {Streptomyces avidinii [TaxId: 1895]} eagitgtwynqlgstfivtagadgaltgtyesavgcaesryvltgrydsapatdgsgtal gwtvawknnyrnchsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv kps
Timeline for d6vjkh_: