Lineage for d1e3ma4 (1e3m A:2-116)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420322Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1420353Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) (S)
    automatically mapped to Pfam PF01624
  5. 1420354Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)
  6. 1420355Protein DNA repair protein MutS, domain I [55273] (2 species)
  7. 1420356Species Escherichia coli [TaxId:562] [55275] (10 PDB entries)
    Uniprot P23909 2-800
  8. 1420360Domain d1e3ma4: 1e3m A:2-116 [39747]
    Other proteins in same PDB: d1e3ma1, d1e3ma2, d1e3ma3, d1e3mb1, d1e3mb2, d1e3mb3
    complexed with adp, mg

Details for d1e3ma4

PDB Entry: 1e3m (more details), 2.2 Å

PDB Description: the crystal structure of e. coli muts binding to dna with a g:t mismatch
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1e3ma4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ma4 d.75.2.1 (A:2-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
saienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgas
agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp

SCOPe Domain Coordinates for d1e3ma4:

Click to download the PDB-style file with coordinates for d1e3ma4.
(The format of our PDB-style files is described here.)

Timeline for d1e3ma4: