Lineage for d1ewqb4 (1ewq B:1001-1120)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33569Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
  4. 33578Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) (S)
  5. 33579Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)
  6. 33580Protein DNA repair protein MutS, domain I [55273] (2 species)
  7. 33584Species Thermus aquaticus [TaxId:271] [55274] (2 PDB entries)
  8. 33586Domain d1ewqb4: 1ewq B:1001-1120 [39744]
    Other proteins in same PDB: d1ewqa1, d1ewqa2, d1ewqa3, d1ewqb1, d1ewqb2, d1ewqb3

Details for d1ewqb4

PDB Entry: 1ewq (more details), 2.2 Å

PDB Description: crystal structure taq muts complexed with a heteroduplex dna at 2.2 a resolution

SCOP Domain Sequences for d1ewqb4:

Sequence, based on SEQRES records: (download)

>d1ewqb4 d.75.2.1 (B:1001-1120) DNA repair protein MutS, domain I {Thermus aquaticus}
megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
ktskdfttpmagiplrafeayaerllkmgfrlavadqvepaeeaeglvrrevtqlltpgt

Sequence, based on observed residues (ATOM records): (download)

>d1ewqb4 d.75.2.1 (B:1001-1120) DNA repair protein MutS, domain I {Thermus aquaticus}
megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
ktskdfttpmagiplrafeayaerllkmgfrlavadqvepvrrevtqlltpgt

SCOP Domain Coordinates for d1ewqb4:

Click to download the PDB-style file with coordinates for d1ewqb4.
(The format of our PDB-style files is described here.)

Timeline for d1ewqb4: