![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
![]() | Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (2 families) ![]() automatically mapped to Pfam PF01624 |
![]() | Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein) |
![]() | Protein DNA repair protein MutS, domain I [55273] (2 species) |
![]() | Species Thermus aquaticus [TaxId:271] [55274] (3 PDB entries) |
![]() | Domain d1ewqb4: 1ewq B:1001-1120 [39744] Other proteins in same PDB: d1ewqa1, d1ewqa2, d1ewqa3, d1ewqb1, d1ewqb2, d1ewqb3 CASP4 protein/DNA complex; complexed with edo, so4 |
PDB Entry: 1ewq (more details), 2.2 Å
SCOPe Domain Sequences for d1ewqb4:
Sequence, based on SEQRES records: (download)
>d1ewqb4 d.75.2.1 (B:1001-1120) DNA repair protein MutS, domain I {Thermus aquaticus [TaxId: 271]} megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth ktskdfttpmagiplrafeayaerllkmgfrlavadqvepaeeaeglvrrevtqlltpgt
>d1ewqb4 d.75.2.1 (B:1001-1120) DNA repair protein MutS, domain I {Thermus aquaticus [TaxId: 271]} megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth ktskdfttpmagiplrafeayaerllkmgfrlavadqvepvrrevtqlltpgt
Timeline for d1ewqb4:
![]() Domains from other chains: (mouse over for more information) d1ewqa1, d1ewqa2, d1ewqa3, d1ewqa4 |