SCOP 1.75: Domain d1ewqa4: 1ewq A:1-120

Lineage for d1ewqa4 (1ewq A:1-120)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
   beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family)

5. Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)

6. Protein DNA repair protein MutS, domain I [55273] (2 species)

7. Species Thermus aquaticus [TaxId:271] [55274] (3 PDB entries)

8. Domain d1ewqa4: 1ewq A:1-120 [39743]
   Other proteins in same PDB: d1ewqa1, d1ewqa2, d1ewqa3, d1ewqb1, d1ewqb2, d1ewqb3
   CASP4

Details for d1ewqa4

PDB Entry: 1ewq, 2.2 Å

PDB Description: crystal structure taq muts complexed with a heteroduplex dna at 2.2 a resolution

PDB Compounds: (A:) DNA mismatch repair protein muts

SCOP Domain Sequences for d1ewqa4:

Sequence; same for both SEQRES and ATOM records:

>d1ewqa4 d.75.2.1 (A:1-120) DNA repair protein MutS, domain I {Thermus aquaticus [TaxId: 271]}
megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
ktskdfttpmagiplrafeayaerllkmgfrlavadqvepaeeaeglvrrevtqlltpgt

Timeline for d1ewqa4:

• d1ewqa4 first appeared (with stable ids) in SCOP 1.55
  
• d1ewqa4 appears in SCOP 1.73
  
• d1ewqa4 appears in SCOPe 2.01
  
• d1ewqa4 appears in the current release, SCOPe 2.08