Lineage for d1ewqa4 (1ewq A:1-120)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958349Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2958380Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (2 families) (S)
    automatically mapped to Pfam PF01624
  5. 2958381Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)
  6. 2958382Protein DNA repair protein MutS, domain I [55273] (2 species)
  7. 2958399Species Thermus aquaticus [TaxId:271] [55274] (3 PDB entries)
  8. 2958400Domain d1ewqa4: 1ewq A:1-120 [39743]
    Other proteins in same PDB: d1ewqa1, d1ewqa2, d1ewqa3, d1ewqb1, d1ewqb2, d1ewqb3
    CASP4
    protein/DNA complex; complexed with edo, so4

Details for d1ewqa4

PDB Entry: 1ewq (more details), 2.2 Å

PDB Description: crystal structure taq muts complexed with a heteroduplex dna at 2.2 a resolution
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1ewqa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewqa4 d.75.2.1 (A:1-120) DNA repair protein MutS, domain I {Thermus aquaticus [TaxId: 271]}
megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
ktskdfttpmagiplrafeayaerllkmgfrlavadqvepaeeaeglvrrevtqlltpgt

SCOPe Domain Coordinates for d1ewqa4:

Click to download the PDB-style file with coordinates for d1ewqa4.
(The format of our PDB-style files is described here.)

Timeline for d1ewqa4: