Lineage for d6m09b_ (6m09 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794133Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2794356Family b.45.1.0: automated matches [191365] (1 protein)
    not a true family
  6. 2794357Protein automated matches [190439] (22 species)
    not a true protein
  7. 2794423Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [397197] (2 PDB entries)
  8. 2794425Domain d6m09b_: 6m09 B: [397290]
    automated match to d5bncb_

Details for d6m09b_

PDB Entry: 6m09 (more details), 2.1 Å

PDB Description: the ligand-free structure of the chloroplast protein at3g03890
PDB Compounds: (B:) AT3G03890 protein

SCOPe Domain Sequences for d6m09b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m09b_ b.45.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
fkliqaheekaarlspveeirtvlngsicgmlstfsqkyegypsgsmvdfacdadgspil
avsslavhtkdllanpkcslliardpedrtglritlhgdavlvsekdqaavrsaylakhp
kafwvdfgdfsfmriepkvvryvsgvataflgsgefskeeyqaakvdpiaqyakpvtshm
nkdheedtkaivhnitsipvesalmldldslgfnvkatlqgntfklrvpfprraqdrkdv
ktlivemlqaak

SCOPe Domain Coordinates for d6m09b_:

Click to download the PDB-style file with coordinates for d6m09b_.
(The format of our PDB-style files is described here.)

Timeline for d6m09b_: