Lineage for d6lz2b_ (6lz2 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759403Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)
  8. 2759411Domain d6lz2b_: 6lz2 B: [397250]
    Other proteins in same PDB: d6lz2a_, d6lz2c_, d6lz2d2
    automated match to d4nbzb_
    complexed with act, crq, gol, na, trs

Details for d6lz2b_

PDB Entry: 6lz2 (more details), 2.03 Å

PDB Description: crystal structure of a thermostable green fluorescent protein (tgp) with a synthetic nanobody (sb44)
PDB Compounds: (B:) synthetic nanobody (sybody) 44 against the thermostable green fluorescent protein (TGP)

SCOPe Domain Sequences for d6lz2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lz2b_ b.1.1.0 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
sqvqlvesggglvqaggslrlscaasgfpvgrasmwwyrqapgkerewvaaissygwvta
yadsvkgrftisrdnakntvylqmnslkpedtavyycevsvgtgyrgqgtqvtvsag

SCOPe Domain Coordinates for d6lz2b_:

Click to download the PDB-style file with coordinates for d6lz2b_.
(The format of our PDB-style files is described here.)

Timeline for d6lz2b_: