SCOPe 2.05: Domain d1b4ac2: 1b4a C:79-149

Lineage for d1b4ac2 (1b4a C:79-149)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families)
   forms trimers with three closely packed beta-sheets

5. Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein)
   automatically mapped to Pfam PF02863

6. Protein C-terminal domain of arginine repressor [55254] (3 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [55256] (2 PDB entries)

8. Domain d1b4ac2: 1b4a C:79-149 [39723]
   Other proteins in same PDB: d1b4aa1, d1b4ab1, d1b4ac1, d1b4ad1, d1b4ae1, d1b4af1

Details for d1b4ac2

PDB Entry: 1b4a, 2.5 Å

PDB Description: structure of the arginine repressor from bacillus stearothermophilus

PDB Compounds: (C:) Arginine repressor

SCOPe Domain Sequences for d1b4ac2:

Sequence; same for both SEQRES and ATOM records:

>d1b4ac2 d.74.2.1 (C:79-149) C-terminal domain of arginine repressor {Bacillus stearothermophilus [TaxId: 1422]}
alvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgticgddtcliicrtpkda
kkvsnqllsml

Timeline for d1b4ac2:

• d1b4ac2 first appeared (with stable ids) in SCOP 1.55
  
• d1b4ac2 appears in SCOPe 2.04
  
• d1b4ac2 appears in SCOPe 2.06
  
• d1b4ac2 appears in the current release, SCOPe 2.08