Lineage for d1b4ab2 (1b4a B:79-149)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 605797Fold d.74: DCoH-like [55247] (4 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 605838Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (1 family) (S)
    forms trimers with three closely packed beta-sheets
  5. 605839Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein)
  6. 605840Protein C-terminal domain of arginine repressor [55254] (3 species)
  7. 605841Species Bacillus stearothermophilus [TaxId:1422] [55256] (2 PDB entries)
  8. 605846Domain d1b4ab2: 1b4a B:79-149 [39722]
    Other proteins in same PDB: d1b4aa1, d1b4ab1, d1b4ac1, d1b4ad1, d1b4ae1, d1b4af1

Details for d1b4ab2

PDB Entry: 1b4a (more details), 2.5 Å

PDB Description: structure of the arginine repressor from bacillus stearothermophilus

SCOP Domain Sequences for d1b4ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4ab2 d.74.2.1 (B:79-149) C-terminal domain of arginine repressor {Bacillus stearothermophilus}
alvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgticgddtcliicrtpkda
kkvsnqllsml

SCOP Domain Coordinates for d1b4ab2:

Click to download the PDB-style file with coordinates for d1b4ab2.
(The format of our PDB-style files is described here.)

Timeline for d1b4ab2: