Lineage for d7kvgb_ (7kvg B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2406861Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2406922Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species)
    contains an extra alpha-helical domain
  7. 2407068Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [385979] (34 PDB entries)
  8. 2407131Domain d7kvgb_: 7kvg B: [397200]
    automated match to d1z1ja_
    mutant

Details for d7kvgb_

PDB Entry: 7kvg (more details), 2.8 Å

PDB Description: sars-cov-2 main protease c145s mutant in complex with n and c-terminal residues
PDB Compounds: (B:) main protease

SCOPe Domain Sequences for d7kvgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kvgb_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddvvycprhvictsedmlnpnyedllir
ksnhnflvqagnvqlrvighsmqncvlklkvdtanpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnftikgsflngssgsvgfnidydcvsfcymhhmelptgvhagtdlegn
fygpfvdrqtaqaagtdttitvnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaslkellqngmngrtilgsalledeftpfdvvrqc
sgvtfq

SCOPe Domain Coordinates for d7kvgb_:

Click to download the PDB-style file with coordinates for d7kvgb_.
(The format of our PDB-style files is described here.)

Timeline for d7kvgb_:

  • d7kvgb_ is new in SCOPe 2.07-stable
  • d7kvgb_ does not appear in SCOPe 2.08

View in 3D
Domains from other chains:
(mouse over for more information)
d7kvga_