Lineage for d1xxbc_ (1xxb C:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726910Fold d.74: DCoH-like [55247] (4 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 726951Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (1 family) (S)
    forms trimers with three closely packed beta-sheets
  5. 726952Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein)
  6. 726953Protein C-terminal domain of arginine repressor [55254] (3 species)
  7. 726971Species Escherichia coli [TaxId:562] [55255] (3 PDB entries)
  8. 726980Domain d1xxbc_: 1xxb C: [39708]

Details for d1xxbc_

PDB Entry: 1xxb (more details), 2.6 Å

PDB Description: c-terminal domain of escherichia coli arginine repressor/ l-arginine complex
PDB Compounds: (C:) Arginine repressor

SCOP Domain Sequences for d1xxbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxbc_ d.74.2.1 (C:) C-terminal domain of arginine repressor {Escherichia coli [TaxId: 562]}
plknlvldidyndavvvihtspgaaqliarlldslgkaegilgtiagddtifttpangft
vkdlyeailelf

SCOP Domain Coordinates for d1xxbc_:

Click to download the PDB-style file with coordinates for d1xxbc_.
(The format of our PDB-style files is described here.)

Timeline for d1xxbc_: