Lineage for d7dm2a_ (7dm2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914680Protein automated matches [190140] (37 species)
    not a true protein
  7. 2914841Species Mycobacterium tuberculosis [TaxId:83332] [335655] (5 PDB entries)
  8. 2914846Domain d7dm2a_: 7dm2 A: [396995]
    Other proteins in same PDB: d7dm2h_, d7dm2l1, d7dm2l2
    automated match to d1pc3a_
    complexed with po4

Details for d7dm2a_

PDB Entry: 7dm2 (more details), 2.4 Å

PDB Description: crystal structure of the m. tuberculosis phosphate abc transport receptor psts-1 in complex with fab p4-170
PDB Compounds: (A:) Phosphate-binding protein pstS 1

SCOPe Domain Sequences for d7dm2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dm2a_ c.94.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tvattpasspvtlaetgstllyplfnlwgpafherypnvtitaqgtgsgagiaqaaagtv
nigasdaylsegdmaahkglmnialaisaqqvnynlpgvsehlklngkvlaamyqgtikt
wddpqiaalnpgvnlpgtavvplhrsdgsgdtflftqylskqdpegwgkspgfgttvdfp
avpgalgengnggmvtgcaetpgcvayigisfldqasqrglgeaqlgnssgnfllpdaqs
iqaaaagfasktpanqaismidgpapdgypiinyeyaivnnrqkdaataqtlqaflhwai
tdgnkasfldqvhfqplppavvklsdaliatiss

SCOPe Domain Coordinates for d7dm2a_:

Click to download the PDB-style file with coordinates for d7dm2a_.
(The format of our PDB-style files is described here.)

Timeline for d7dm2a_: