Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein automated matches [190140] (37 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [335655] (5 PDB entries) |
Domain d7dm2a_: 7dm2 A: [396995] Other proteins in same PDB: d7dm2h_, d7dm2l1, d7dm2l2 automated match to d1pc3a_ complexed with po4 |
PDB Entry: 7dm2 (more details), 2.4 Å
SCOPe Domain Sequences for d7dm2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dm2a_ c.94.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} tvattpasspvtlaetgstllyplfnlwgpafherypnvtitaqgtgsgagiaqaaagtv nigasdaylsegdmaahkglmnialaisaqqvnynlpgvsehlklngkvlaamyqgtikt wddpqiaalnpgvnlpgtavvplhrsdgsgdtflftqylskqdpegwgkspgfgttvdfp avpgalgengnggmvtgcaetpgcvayigisfldqasqrglgeaqlgnssgnfllpdaqs iqaaaagfasktpanqaismidgpapdgypiinyeyaivnnrqkdaataqtlqaflhwai tdgnkasfldqvhfqplppavvklsdaliatiss
Timeline for d7dm2a_: