SCOPe 2.08: Domain d7a0vf1: 7a0v F:1-121

Lineage for d7a0vf1 (7a0v F:1-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)

8. Domain d7a0vf1: 7a0v F:1-121 [396835]
   Other proteins in same PDB: d7a0vb2, d7a0vd2, d7a0vf2
   automated match to d4nc2b_
   complexed with gol, mg, po4

Details for d7a0vf1

PDB Entry: 7a0v, 2.3 Å

PDB Description: crystal structure of the 5-phosphatase domain of synaptojanin1 in complex with a nanobody

PDB Compounds: (F:) Nanobody 13015

SCOPe Domain Sequences for d7a0vf1:

Sequence; same for both SEQRES and ATOM records:

>d7a0vf1 b.1.1.0 (F:1-121) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesgggfaqaggslrlscaasgstfrframgwfrqapgkerefvagiswsgstkyt
dsvkgrftisrdnakntvhlqmnnltpedtavyycaqsraieaddsrgydywgqgtqvtv
s

Timeline for d7a0vf1:

• d7a0vf1 first appeared in SCOPe 2.07