SCOP 1.59: Domain d1rscm_: 1rsc M:

Lineage for d1rscm_ (1rsc M:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species)

7. Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [55246] (2 PDB entries)

8. Domain d1rscm_: 1rsc M: [39671]
   Other proteins in same PDB: d1rsca1, d1rsca2

Details for d1rscm_

PDB Entry: 1rsc, 2.3 Å

PDB Description: structure of an effector induced inactivated state of ribulose bisphosphate carboxylase(slash)oxygenase: the binary complex between enzyme and xylulose bisphosphate

SCOP Domain Sequences for d1rscm_:

Sequence; same for both SEQRES and ATOM records:

>d1rscm_ d.73.1.1 (M:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301}
smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
lfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgr

Timeline for d1rscm_:

• d1rscm_ first appeared (with stable ids) in SCOP 1.55
  
• d1rscm_ appears in SCOP 1.57
  
• d1rscm_ appears in SCOP 1.61
  
• d1rscm_ appears in the current release, SCOPe 2.08