Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) |
Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species) |
Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [55246] (2 PDB entries) |
Domain d1rscm_: 1rsc M: [39671] Other proteins in same PDB: d1rsca1, d1rsca2 |
PDB Entry: 1rsc (more details), 2.3 Å
SCOP Domain Sequences for d1rscm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rscm_ d.73.1.1 (M:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301} smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp lfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgr
Timeline for d1rscm_: