SCOP 1.61: Domain d1rblm_: 1rbl M:

Lineage for d1rblm_ (1rbl M:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species)

7. Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [55246] (2 PDB entries)

8. Domain d1rblm_: 1rbl M: [39670]
   Other proteins in same PDB: d1rbla1, d1rbla2

Details for d1rblm_

PDB Entry: 1rbl, 2.2 Å

PDB Description: structure determination and refinement of ribulose 1,5 bisphosphate carboxylase(slash)oxygenase from synechococcus pcc6301

SCOP Domain Sequences for d1rblm_:

Sequence; same for both SEQRES and ATOM records:

>d1rblm_ d.73.1.1 (M:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301}
smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
lfacaapqqvldevrecrseygdcyirvagfdnikecqtssfivhrpgr

Timeline for d1rblm_:

• d1rblm_ first appeared (with stable ids) in SCOP 1.55
  
• d1rblm_ appears in SCOP 1.59
  
• d1rblm_ appears in SCOP 1.63
  
• d1rblm_ appears in the current release, SCOPe 2.08