SCOPe 2.08: Domain d6zi6h1: 6zi6 H:1-36

Lineage for d6zi6h1 (6zi6 H:1-36)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families)

5. Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)

6. Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81485] (26 PDB entries)
   synonym: blastochloris viridis

8. Domain d6zi6h1: 6zi6 H:1-36 [396697]
   Other proteins in same PDB: d6zi6c_, d6zi6h2, d6zi6l_, d6zi6m_
   automated match to d1r2ch2
   complexed with bcb, bpb, dga, fe, hec, hto, lda, mq7, ns5, so4

Details for d6zi6h1

PDB Entry: 6zi6, 2.8 Å

PDB Description: ultrafast structural response to charge redistribution within a photosynthetic reaction centre - 20 ps structure

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d6zi6h1:

Sequence; same for both SEQRES and ATOM records:

>d6zi6h1 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

Timeline for d6zi6h1:

• d6zi6h1 first appeared in SCOPe 2.07