Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) |
Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (5 species) |
Species Alcaligenes eutrophus [TaxId:106590] [55245] (1 PDB entry) |
Domain d1bxnl_: 1bxn L: [39669] Other proteins in same PDB: d1bxna1, d1bxna2, d1bxnc1, d1bxnc2, d1bxne1, d1bxne2, d1bxng1, d1bxng2 |
PDB Entry: 1bxn (more details), 2.7 Å
SCOP Domain Sequences for d1bxnl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bxnl_ d.73.1.1 (L:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Alcaligenes eutrophus} mritqgtfsflpeltdeqitkqleyclnqgwavgleytddphprntywemfglpmfdlrd aagilmeinnarntfpnhyirvtafdsthtvesvvmsfivnrpadepgfrlvrqeepgrt lrysiesya
Timeline for d1bxnl_: