SCOPe 2.03: Domain d1bxni_: 1bxn I:

Lineage for d1bxni_ (1bxn I:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)

7. Species Alcaligenes eutrophus [TaxId:106590] [55245] (1 PDB entry)

8. Domain d1bxni_: 1bxn I: [39666]
   Other proteins in same PDB: d1bxna1, d1bxna2, d1bxnc1, d1bxnc2, d1bxne1, d1bxne2, d1bxng1, d1bxng2
   complexed with po4

Details for d1bxni_

PDB Entry: 1bxn, 2.7 Å

PDB Description: the crystal structure of rubisco from alcaligenes eutrophus to 2.7 angstroms.

PDB Compounds: (I:) protein (ribulose bisphosphate carboxylase small chain)

SCOPe Domain Sequences for d1bxni_:

Sequence; same for both SEQRES and ATOM records:

>d1bxni_ d.73.1.1 (I:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Alcaligenes eutrophus [TaxId: 106590]}
mritqgtfsflpeltdeqitkqleyclnqgwavgleytddphprntywemfglpmfdlrd
aagilmeinnarntfpnhyirvtafdsthtvesvvmsfivnrpadepgfrlvrqeepgrt
lrysiesya

Timeline for d1bxni_:

• d1bxni_ first appeared (with stable ids) in SCOP 1.55
  
• d1bxni_ appears in SCOPe 2.02
  
• d1bxni_ appears in SCOPe 2.04
  
• d1bxni_ appears in the current release, SCOPe 2.08