Lineage for d1bwvw_ (1bwv W:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33418Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
  4. 33419Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 33420Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 33421Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (5 species)
  7. 33427Species Galdieria partita [TaxId:83374] [55244] (1 PDB entry)
  8. 33430Domain d1bwvw_: 1bwv W: [39664]
    Other proteins in same PDB: d1bwva1, d1bwva2, d1bwvc1, d1bwvc2, d1bwve1, d1bwve2, d1bwvg1, d1bwvg2

Details for d1bwvw_

PDB Entry: 1bwv (more details), 2.4 Å

PDB Description: Activated Ribulose 1,5-Bisphosphate Carboxylase/Oxygenase (RUBISCO) Complexed with the Reaction Intermediate Analogue 2-Carboxyarabinitol 1,5-Bisphosphate

SCOP Domain Sequences for d1bwvw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bwvw_ d.73.1.1 (W:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita}
vritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
ikytihsyesykpedery

SCOP Domain Coordinates for d1bwvw_:

Click to download the PDB-style file with coordinates for d1bwvw_.
(The format of our PDB-style files is described here.)

Timeline for d1bwvw_: