Lineage for d1rcxm_ (1rcx M:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1913207Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1913208Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1913209Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1913210Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 1913287Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries)
  8. 1913331Domain d1rcxm_: 1rcx M: [39658]
    Other proteins in same PDB: d1rcxb1, d1rcxb2, d1rcxe1, d1rcxe2, d1rcxh1, d1rcxh2, d1rcxk1, d1rcxk2, d1rcxl1, d1rcxl2, d1rcxo1, d1rcxo2, d1rcxr1, d1rcxr2, d1rcxv1, d1rcxv2
    complexed with rub

Details for d1rcxm_

PDB Entry: 1rcx (more details), 2.4 Å

PDB Description: non-activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate
PDB Compounds: (M:) ribulose bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1rcxm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcxm_ d.73.1.1 (M:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

SCOPe Domain Coordinates for d1rcxm_:

Click to download the PDB-style file with coordinates for d1rcxm_.
(The format of our PDB-style files is described here.)

Timeline for d1rcxm_: