![]() | Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
![]() | Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) |
![]() | Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) ![]() |
![]() | Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species) |
![]() | Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries) |
![]() | Domain d1rcxm_: 1rcx M: [39658] Other proteins in same PDB: d1rcxb1, d1rcxb2, d1rcxe1, d1rcxe2, d1rcxh1, d1rcxh2, d1rcxk1, d1rcxk2, d1rcxl1, d1rcxl2, d1rcxo1, d1rcxo2, d1rcxr1, d1rcxr2, d1rcxv1, d1rcxv2 |
PDB Entry: 1rcx (more details), 2.4 Å
SCOP Domain Sequences for d1rcxm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rcxm_ d.73.1.1 (M:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)} mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp agy
Timeline for d1rcxm_: