Lineage for d1rcom_ (1rco M:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957671Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2957672Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species)
  7. 2957754Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries)
  8. 2957778Domain d1rcom_: 1rco M: [39650]
    Other proteins in same PDB: d1rcob1, d1rcob2, d1rcoe1, d1rcoe2, d1rcoh1, d1rcoh2, d1rcok1, d1rcok2, d1rcol1, d1rcol2, d1rcoo1, d1rcoo2, d1rcor1, d1rcor2, d1rcov1, d1rcov2
    complexed with xdp

Details for d1rcom_

PDB Entry: 1rco (more details), 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor d-xylulose-2,2-diol-1,5-bisphosphate
PDB Compounds: (M:) ribulose bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1rcom_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcom_ d.73.1.1 (M:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

SCOPe Domain Coordinates for d1rcom_:

Click to download the PDB-style file with coordinates for d1rcom_.
(The format of our PDB-style files is described here.)

Timeline for d1rcom_: