SCOPe 2.08: Domain d1rcof_: 1rco F:

Lineage for d1rcof_ (1rco F:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries)

8. Domain d1rcof_: 1rco F: [39648]
   Other proteins in same PDB: d1rcob1, d1rcob2, d1rcoe1, d1rcoe2, d1rcoh1, d1rcoh2, d1rcok1, d1rcok2, d1rcol1, d1rcol2, d1rcoo1, d1rcoo2, d1rcor1, d1rcor2, d1rcov1, d1rcov2
   complexed with xdp

Details for d1rcof_

PDB Entry: 1rco, 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor d-xylulose-2,2-diol-1,5-bisphosphate

PDB Compounds: (F:) ribulose bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1rcof_:

Sequence; same for both SEQRES and ATOM records:

>d1rcof_ d.73.1.1 (F:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

Timeline for d1rcof_:

• d1rcof_ first appeared (with stable ids) in SCOP 1.55
  
• d1rcof_ appears in SCOPe 2.07