Lineage for d1auss_ (1aus S:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656663Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1656664Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1656665Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1656666Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 1656743Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries)
  8. 1656764Domain d1auss_: 1aus S: [39645]
    Other proteins in same PDB: d1ausl1, d1ausl2, d1ausm1, d1ausm2, d1ausn1, d1ausn2, d1auso1, d1auso2
    complexed with fmt, mg

Details for d1auss_

PDB Entry: 1aus (more details), 2.2 Å

PDB Description: activated unliganded spinach rubisco
PDB Compounds: (S:) ribulose bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1auss_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auss_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

SCOPe Domain Coordinates for d1auss_:

Click to download the PDB-style file with coordinates for d1auss_.
(The format of our PDB-style files is described here.)

Timeline for d1auss_: